PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007254m
Common NameCARUB_v10007254mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 222aa    MW: 25166.2 Da    PI: 6.6343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007254mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-172269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
  Carubv10007254m 22 KGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 69
                     79********************************************97 PP

2Myb_DNA-binding52.89.1e-1775118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++++ ++++++G++ W++Ia++++ gRt++++k++w++
  Carubv10007254m  75 RGNITAEEQLIIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 118
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-231772IPR009057Homeodomain-like
PROSITE profilePS5129416.2321769IPR017930Myb domain
SuperFamilySSF466897.11E-3019116IPR009057Homeodomain-like
SMARTSM007178.1E-132171IPR001005SANT/Myb domain
PfamPF002491.6E-162269IPR001005SANT/Myb domain
CDDcd001673.83E-102469No hitNo description
PROSITE profilePS5129424.09270124IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-2473123IPR009057Homeodomain-like
SMARTSM007171.0E-1474122IPR001005SANT/Myb domain
PfamPF002492.9E-1575118IPR001005SANT/Myb domain
CDDcd001671.76E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEKREGSGTG GSGSSGDADV RKGPWTMEED LILINYIANH GEGVWNSLAK SAGLKRTGKS  60
CRLRWLNYLR PDVRRGNITA EEQLIIMELH AKWGNRWSKI AKHLPGRTDN EIKNFWRTKI  120
QKYIIKNGET TTTAGLQSSE IMNHHVTSTS KVLNDTLEEP MDLYSPTTSY QYANNIDHLQ  180
LSYGTYVPES DSIMMPLSID QDVQNYWSVD DLWPMHLYNG N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27161241108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759870.0AF175987.1 Arabidopsis thaliana putative transcription factor (MYB24) mRNA, complete cds.
GenBankAY5196320.0AY519632.1 Arabidopsis thaliana MYB transcription factor (At5g40350) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285780.11e-165hypothetical protein CARUB_v10007254mg
SwissprotQ9SPG91e-127MYB24_ARATH; Transcription factor MYB24
TrEMBLR0H5581e-165R0H558_9BRAS; Uncharacterized protein
STRINGAT5G40350.11e-124(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.11e-128myb domain protein 24